Paraconexibacter sp. AEG42_29: DSM112329_04448 Help Entry DSM112329_04448   CDS       T10662                                  Symbol acpP_2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism parq  Paraconexibacter sp. AEG42_29 Pathway parq01100   Metabolic pathways parq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:parq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DSM112329_04448 (acpP_2)    00074 Mycolic acid biosynthesis     DSM112329_04448 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DSM112329_04448 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF3756 Motif Other DBs NCBI-ProteinID:  XAY07563 UniProt:  A0AAU7B104 LinkDB All DBs Position 4582299..4582544 Genome browser AA seq 81 aa AA seqDB search MPSTITTEAVEKTVVDALISFGAEPSEVAPATELTTLDIDSLDLAELSQIVDDEYGVSMK SSDVSKIKTVGDIVALIVSKG NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcccagcaccatcaccaccgaagccgtcgagaagacggtcgtcgacgcactcatctcc ttcggcgccgagccgtccgaggtcgcgcccgcaaccgagctcacgacgctcgacatcgac tccctcgacctggcggagctctcgcagatcgtcgacgacgagtacggcgtgtccatgaag agcagcgacgtctccaagatcaagacggttggcgacatcgtcgcgctcatcgtctccaag ggctga

DBGET integrated database retrieval system