Paracoccus suum: DRW48_12185 Help Entry DRW48_12185       CDS       T05723                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pars  Paracoccus suum Pathway pars01100   Metabolic pathways pars01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pars00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DRW48_12185    00074 Mycolic acid biosynthesis     DRW48_12185   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DRW48_12185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  AXC50354 UniProt:  A0A344PLU9 LinkDB All DBs Position 2495348..2495611 Genome browser AA seq 87 aa AA seqDB search MSQTRDRIIQIIAEQAMLDPGEVDMAMTPSDLGIDSLGLVEAIFALEEAFDITVPFNANE PDKSDFDISSVGAIVGAVERLVAAKGA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagccagaccagggaccgcatcattcagatcatcgccgagcaggcgatgctcgatccc ggtgaggtcgacatggctatgacgccgtccgaccttgggatcgacagtctgggactggta gaggcgatcttcgcgctcgaggaggcgttcgacatcaccgtgcccttcaacgccaacgag ccggacaagtcggattttgacatctcgtcggtcggagcgatcgtaggtgcggtcgagcgg ctcgtcgccgccaagggcgcatga

DBGET integrated database retrieval system