Pseudoalteromonas arctica: PARC_a3811 Help Entry PARC_a3811        CDS       T05179                                  Symbol trxA Name (GenBank) thioredoxin 1   KO K03671   thioredoxin Organism part  Pseudoalteromonas arctica Brite KEGG Orthology (KO) [BR:part00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:part03110]     PARC_a3811 (trxA) Chaperones and folding catalysts [BR:part03110]  Protein folding catalysts   Protein disulfide isomerase    PARC_a3811 (trxA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 TraF HyaE Thioredoxin_6 Motif Other DBs NCBI-ProteinID:  ATC88136 UniProt:  A0A290S7S2 LinkDB All DBs Position I:3695466..3695681 Genome browser AA seq 71 aa AA seqDB search MIAPILHEVADEYDSRVTVAKLNIDQNAGTPPKFGIRGIPTLLLFKDGQVAATKVGALSK TQLIEFLENNI NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgatcgcccctattcttcacgaagttgctgatgaatacgacagccgtgtgactgttgct aaattaaacattgaccaaaatgctggcacaccgccaaaatttggtattcgtggtatccct actttacttctttttaaagatggccaagtagctgcaacgaaagtaggtgctctttcaaaa actcaacttatcgagtttttagaaaacaacatctaa

DBGET integrated database retrieval system