Muribaculum intestinale: A4V02_02520 Help Entry A4V02_02520       CDS       T04438                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pary  Muribaculum intestinale Pathway pary00020   Citrate cycle (TCA cycle) pary00720   Other carbon fixation pathways pary01100   Metabolic pathways pary01110   Biosynthesis of secondary metabolites pary01120   Microbial metabolism in diverse environments pary01200   Carbon metabolism pary01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pary00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     A4V02_02520   09102 Energy metabolism    00720 Other carbon fixation pathways     A4V02_02520 Enzymes [BR:pary01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      A4V02_02520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_2 Fer4_10 Fer4_21 Fer4_9 Fer4_16 Fer4_4 Fer4_17 Fer4_3 Fer4_15 Fer4_8 Fer4_22 Fer4_13 Fer4_18 Motif Other DBs NCBI-ProteinID:  ANU62708 UniProt:  A0A1B1S7E3 LinkDB All DBs Position complement(650226..650456) Genome browser AA seq 76 aa AA seqDB search MAKVFGAVVIDTDRCKGCDLCVVACPKDVLSLQGKEVNDRGYHFAYTVRPADCIGCANCA VVCPDGCIEVYRALEK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcaaaagtatttggagcagtggtaatcgacactgaccgttgcaagggatgcgatctc tgcgtggtggcatgtccgaaagatgtgctctcgctgcagggcaaggaggttaacgaccgt ggctaccacttcgcatataccgtgcgccccgccgattgcatcggatgtgccaactgtgcc gtggtgtgtcccgacggatgcattgaggtatatcgtgccctcgagaaatag

DBGET integrated database retrieval system