Peribacillus asahii: BAOM_4697 Help Entry BAOM_4697         CDS       T06700                                  Symbol flgM Name (GenBank) anti-sigma-28 factor FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism pasa  Peribacillus asahii Pathway pasa02020   Two-component system pasa02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pasa00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BAOM_4697 (flgM)  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     BAOM_4697 (flgM)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pasa02035]     BAOM_4697 (flgM) Bacterial motility proteins [BR:pasa02035]  Flagellar system   Flagellar assembly proteins    Others     BAOM_4697 (flgM) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM dbPDZ_assoc Motif Other DBs NCBI-ProteinID:  AZV45275 UniProt:  A0A3Q9RRN7 LinkDB All DBs Position complement(4426507..4426770) Genome browser AA seq 87 aa AA seqDB search MKIHSFGVSRVNPYNLQANKMDNQKLSHKKAVDKLEISSEAKVMQEGSSIQAERQAKIEQ LKRQVENGTYTLDSKATAKGIIDYFKR NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaaaattcattcttttggtgtatcgagggtaaatccttataatctgcaagcgaacaaa atggacaaccagaagctttctcataagaaagcagtcgataaattagagatttcttcggag gctaaagtgatgcaggaaggctccagtattcaagctgaaagacaggcaaaaatcgaacag ctgaagcgccaagtagagaatggcacatatacgttggattcaaaggccacagctaaaggg attatcgattattttaaacgttaa

DBGET integrated database retrieval system