Pseudomonas asgharzadehiana: KSS96_27490 Help Entry KSS96_27490       CDS       T07697                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism pasg  Pseudomonas asgharzadehiana Brite KEGG Orthology (KO) [BR:pasg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pasg03036]     KSS96_27490 Chromosome and associated proteins [BR:pasg03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     KSS96_27490 SSDB OrthologParalogGFIT Motif Pfam:  Asd-4 ZapB_rel TPR_MLP1_2 ZapB VGPC1_C ZNF318_helical Macoilin Motif Other DBs NCBI-ProteinID:  QXH67279 UniProt:  A0ABX8P114 LinkDB All DBs Position 6030235..6030444 Genome browser AA seq 69 aa AA seqDB search MEDTDLQALMARLELLITRVEQLKSQNGLLLAQEKTWREERAHLIEKNEIARRKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacaccgacctgcaagcgctgatggccagactcgaattgctaattactcgggtc gagcaacttaagagtcaaaacggactcctattagctcaggaaaagacctggcgcgaggaa cgcgctcacctcattgaaaaaaacgaaatcgctcggcgtaaggtcgaatcgatgatttcg cgcctgaaggccctggagcaagactcatga

DBGET integrated database retrieval system