Paenibacillus sp. S02: KAI36_04881 Help Entry KAI36_04881       CDS       T11472                                  Name (GenBank) Anti-sigma-28 factor, FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism pasz  Paenibacillus sp. S02 Pathway pasz02020   Two-component system pasz02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pasz00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     KAI36_04881  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     KAI36_04881  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pasz02035]     KAI36_04881 Bacterial motility proteins [BR:pasz02035]  Flagellar system   Flagellar assembly proteins    Others     KAI36_04881 SSDB OrthologParalogGFIT Motif Pfam:  FlgM DUF6800 HrpJ Motif Other DBs NCBI-ProteinID:  QYK69673 LinkDB All DBs Position complement(5461150..5461425) Genome browser AA seq 91 aa AA seqDB search MKINETNRIGAINPYQRNIETGRQEEQKKSRRKDEVSISPEAMEMLNRSSDADRVKKIQE LKQQVASGTYSVDADKIAEKLLPYFKQSSES NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaaattaacgagaccaaccgcatcggagctattaatccatatcagcgaaatattgaa acaggacgtcaagaggagcaaaagaaatcccgccgcaaggacgaggtttcgatttctccg gaagcaatggaaatgctgaatcgcagcagtgatgcagaccgcgttaagaaaattcaggag cttaagcagcaagtagcttctggaacctacagtgtggatgccgataaaattgcagagaag ctgttaccttacttcaagcagtcttctgaaagctag

DBGET integrated database retrieval system