Paraglaciecola sp. T6c: Patl_3856 Help Entry Patl_3856         CDS       T00372                                  Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism pat  Paraglaciecola sp. T6c Brite KEGG Orthology (KO) [BR:pat00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pat03036]     Patl_3856 Chromosome and associated proteins [BR:pat03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     Patl_3856 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC SDH_C Motif Other DBs NCBI-ProteinID:  ABG42356 UniProt:  Q15P32 LinkDB All DBs Position 4652929..4653207 Genome browser AA seq 92 aa AA seqDB search MKVVPILLFVLLAALQYRLWFGKNSIPEYVAMEKSVAEQAEQNTELLQRNNLLKADIQDL KVGLEAVEERARNELGLIKQGETFYRILPSEE NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaaagtagtccccatactccttttcgttctgttggctgcgctgcaatatcgcttatgg tttggtaaaaacagtattccagagtacgtcgccatggaaaaatcggtggcagagcaagcc gagcaaaacactgagctattgcagcgtaataatttgctcaaagctgacattcaagaccta aaagtaggcctggaagcggttgaagagcgagcaagaaacgaacttggcctcattaagcaa ggcgaaaccttctatcgaatactcccaagcgaagaatag

DBGET integrated database retrieval system