Pseudomonas atacamensis: JWU58_08150 Help Entry JWU58_08150       CDS       T07336                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pata  Pseudomonas atacamensis Pathway pata01100   Metabolic pathways pata01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pata00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JWU58_08150 (acpP)    00074 Mycolic acid biosynthesis     JWU58_08150 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JWU58_08150 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  QSL89246 LinkDB All DBs Position 1777120..1777356 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgttgccgagcaactgggtgttaaagaa gaagaagtggtcaacaccgcttccttcgtagaagacctgggtgccgactcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagct gaaaagatcactactgtacaagctgcaatcgactacgttaccagccaccaggcgtaa

DBGET integrated database retrieval system