Pseudomonas atacamensis: JWU58_09205 Help Entry JWU58_09205       CDS       T07336                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pata  Pseudomonas atacamensis Pathway pata00261   Monobactam biosynthesis pata01100   Metabolic pathways pata01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pata00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     JWU58_09205  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pata01008]     JWU58_09205 Polyketide biosynthesis proteins [BR:pata01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     JWU58_09205 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QSL89450 LinkDB All DBs Position 2014812..2015036 Genome browser AA seq 74 aa AA seqDB search MTSVFDREDILFQVVVNHEEQYSIWPDYKAVPQGWRTVGKSGLKKECLAYIEEVWTDMRP LSLRQKMDAQVAAQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgtcagtattcgaccgcgaggacatcctctttcaggtcgtggtcaaccacgaagag caatactcgatctggcccgattacaaagctgtgccgcaaggctggcgcaccgtgggcaag agcggcctgaaaaaggaatgcctggcctatatcgaagaagtctggaccgacatgcgtccg ttgagcctgcgccagaagatggatgcacaagtcgcggcgcaataa

DBGET integrated database retrieval system