Pectobacterium atrosepticum 21A: GZ59_09930 Help Entry GZ59_09930        CDS       T03293                                  Symbol cfa1 Name (GenBank) Cfa-acyl carrier protein   KO K02078   acyl carrier protein Organism pato  Pectobacterium atrosepticum 21A Pathway pato00998   Biosynthesis of various antibiotics pato01100   Metabolic pathways pato01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pato00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GZ59_09930 (cfa1)    00074 Mycolic acid biosynthesis     GZ59_09930 (cfa1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GZ59_09930 (cfa1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIK12856 UniProt:  M4GWZ3 LinkDB All DBs Position complement(1063736..1064011) Genome browser AA seq 91 aa AA seqDB search MKNIENTIIGILIDDLFIGIPRSEIETDINMRDGLGLDSLGFSELRAQCEYAFNIKIEDE YFTPQYFDSIQTLTKLTSELILESNKQGENQ NT seq 276 nt NT seq  +upstreamnt  +downstreamnt ttgaaaaacatagaaaacaccattatcggaattctaatcgacgatctatttattggcatc cctcgttcagaaattgagacagatatcaatatgcgtgatggccttggtctagattcctta gggttcagtgaactacgagcccagtgtgagtatgcctttaacatcaaaattgaagatgaa tactttactcctcaatatttcgactcaattcaaacgctcacaaaattgacttcagaatta atcctagaatcaaataagcagggagaaaaccaatga

DBGET integrated database retrieval system