Pectobacterium atrosepticum 21A: GZ59_46020 Help Entry GZ59_46020        CDS       T03293                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism pato  Pectobacterium atrosepticum 21A Pathway pato00998   Biosynthesis of various antibiotics pato01100   Metabolic pathways pato01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pato00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GZ59_46020    00074 Mycolic acid biosynthesis     GZ59_46020   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GZ59_46020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF3913 Motif Other DBs NCBI-ProteinID:  AIK16285 LinkDB All DBs Position complement(4972118..4972366) Genome browser AA seq 82 aa AA seqDB search MDKNEIYQEITGLLVKLFELDADDIKPESRLYEDLELDSIDAVDMVVHLQKRIGRKISPE IFKSVRTVQDVADAVENLLREG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggataaaaacgaaatttatcaggagattacaggcttactggtcaagttatttgaactg gatgctgatgatatcaaacctgaatcccgcctctatgaagatcttgagttagatagcatt gatgcggtggatatggtggttcacctgcaaaaacgcatcgggcgtaaaatatcgccagaa atttttaaatccgtgcgtaccgtgcaggatgtggcggatgcagtagaaaatctgctccgt gaaggctga

DBGET integrated database retrieval system