Pectobacterium atrosepticum 21A: GZ59_46030 Help Entry GZ59_46030        CDS       T03293                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism pato  Pectobacterium atrosepticum 21A Pathway pato00998   Biosynthesis of various antibiotics pato01100   Metabolic pathways pato01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pato00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GZ59_46030    00074 Mycolic acid biosynthesis     GZ59_46030   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GZ59_46030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIK16286 LinkDB All DBs Position complement(4972387..4972653) Genome browser AA seq 88 aa AA seqDB search MESLFIEIKEMIIDSLNLEDISVDEIETDAPLFGEGLGLDSIDALELGLAVKNRYGVVLS AESEEVRQHFFSVATLATFINTQRAVSA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggaaagtctatttattgaaatcaaagagatgattattgattctcttaatcttgaagat atcagtgttgatgaaatagaaacggacgctccgctttttggcgagggtcttggtctggat tctatcgatgcacttgagctgggattagcggttaaaaaccgttacggcgtcgtactttct gctgaaagtgaagaggtgcgccaacactttttttctgttgccacccttgctacttttatt aacactcagcgcgctgtgagtgcctga

DBGET integrated database retrieval system