Pectobacterium atrosepticum JG10-08: EV46_22420 Help Entry EV46_22420        CDS       T03199                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism patr  Pectobacterium atrosepticum JG10-08 Pathway patr00998   Biosynthesis of various antibiotics patr01100   Metabolic pathways patr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:patr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EV46_22420    00074 Mycolic acid biosynthesis     EV46_22420   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EV46_22420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIA73256 LinkDB All DBs Position complement(4985507..4985773) Genome browser AA seq 88 aa AA seqDB search MESLFIEIKEMIIDSLNLEDISVDEIETDAPLFGEGLGLDSIDALELGLAVKNRYGVVLS AESEEVRQHFFSVATLATFINTQRAVSA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggaaagtctatttattgaaatcaaagagatgattattgattctcttaatcttgaagat atcagtgttgatgaaatagaaacggacgctccgctttttggcgagggtcttggtctggat tctatcgatgcacttgagctgggattagcggttaaaaaccgttacggcgtcgtactttct gctgaaagtgaagaggtgcgccaacactttttttctgttgccacccttgctacttttatt aacactcagcgcgctgtgagtgcctga

DBGET integrated database retrieval system