Pseudomonas aeruginosa UCBPP-PA14: PA14_25670 Help Entry PA14_25670        CDS       T00401                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pau  Pseudomonas aeruginosa UCBPP-PA14 Pathway pau01100   Metabolic pathways pau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pau00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PA14_25670 (acpP)    00074 Mycolic acid biosynthesis     PA14_25670 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PA14_25670 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH DUF1896 TerB Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ABJ12204 UniProt:  A0A0H2ZD34 LinkDB All DBs Position 2244161..2244397 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEKA EKITTVQEAIDYIVAHQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgttaagaagatcgtcgctgaacaactcggcgtgaaggaa gaagaagtcaccaacagcgcttccttcgtcgaagacctgggcgccgactcccttgacacc gtcgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgagaaagct gaaaagatcaccaccgttcaggaagccatcgactacatcgttgctcaccagcaataa

DBGET integrated database retrieval system