Phragmites australis (common reed): 133884061 Help Entry 133884061         CDS       T10575                                  Name (RefSeq) SKP1-like protein 6   KO K03094   S-phase kinase-associated protein 1 Organism paua  Phragmites australis (common reed) Pathway paua03083   Polycomb repressive complex paua04120   Ubiquitin mediated proteolysis paua04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:paua00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     133884061    04120 Ubiquitin mediated proteolysis     133884061   09126 Chromosome    03083 Polycomb repressive complex     133884061  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:paua04131]     133884061    04121 Ubiquitin system [BR:paua04121]     133884061    03036 Chromosome and associated proteins [BR:paua03036]     133884061 Membrane trafficking [BR:paua04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     133884061 Ubiquitin system [BR:paua04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      133884061    Cul7 complex      133884061 Chromosome and associated proteins [BR:paua03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      133884061   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      133884061 SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  133884061 NCBI-ProteinID:  XP_062179438 LinkDB All DBs Position 11:22032962..22033348 Genome browser AA seq 128 aa AA seqDB search MSPSAEKKPADDSTTTFAVAEEEKVVLCCSDGVEFVVDVSVTKMSGMISNMIDDECVEGG VPLPNVEGQVMSRVLEYLGKKHGSAAAEDFKKFKSEFLEELVADKKALFDVILAANYLHT QELLDTAF NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtcgccgtcagccgagaagaagcccgcggatgatagtaccaccaccttcgccgtggct gaggaggagaaggtcgtgctgtgctgcagcgacggggtggagttcgtggtggacgtgtct gtcacaaagatgtccgggatgatcagcaacatgattgatgacgagtgcgtggaaggcggc gtcccgctgccgaacgtcgagggccaagtcatgtccagggtgctcgagtacctcggcaag aagcacggtagcgccgccgctgaggacttcaagaagttcaagtcggagttcttagaggag ctggtggccgacaagaaggcgctgtttgacgtgatcctggcggcaaactacctccacacg caagagctgctagacacggcgttctag

DBGET integrated database retrieval system