Phragmites australis (common reed): 133885660 Help Entry 133885660         CDS       T10575                                  Name (RefSeq) rac-like GTP-binding protein 2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism paua  Phragmites australis (common reed) Pathway paua04145   Phagosome paua04148   Efferocytosis paua04517   IgSF CAM signaling paua04518   Integrin signaling paua04519   Cadherin signaling paua04620   Toll-like receptor signaling pathway paua05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:paua00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     133885660    04518 Integrin signaling     133885660    04519 Cadherin signaling     133885660  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     133885660    04148 Efferocytosis     133885660  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     133885660  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     133885660  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:paua04131]     133885660   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:paua04147]     133885660    04031 GTP-binding proteins [BR:paua04031]     133885660 Membrane trafficking [BR:paua04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     133885660  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     133885660   Macropinocytosis    Ras GTPases     133885660  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     133885660 Exosome [BR:paua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    133885660   Exosomal proteins of other body fluids (saliva and urine)    133885660   Exosomal proteins of colorectal cancer cells    133885660   Exosomal proteins of bladder cancer cells    133885660 GTP-binding proteins [BR:paua04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     133885660 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA Motif Other DBs NCBI-GeneID:  133885660 NCBI-ProteinID:  XP_062181383 LinkDB All DBs Position 11:30127615..30130337 Genome browser AA seq 212 aa AA seqDB search MSVTKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVSVDGNIVNLGLWD TAGQEDYSRLRPLSYRGADVFVLAFSLISRASYENVLKKWMPELRRFAPNVPVILVGTKL DLRDHRAYLADHPGASTITTAEGEELRKQIGAAAYIECSSKTQQNVKVVFDTAIKVVLQP PRRREAMTPRKKSKKSSGRSIMSLMCGSTCVA NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atgagcgtgaccaagttcataaagtgcgtgacggtgggggacggcgcggtgggcaagacc tgcatgctcatctgctacaccagcaacaagttccccactgattacatccccacggtgttc gacaatttcagtgccaatgtttccgtggatgggaacattgtcaacttgggtctctgggac actgccgggcaagaggactacagcaggttgaggccactgagctacaggggcgcagacgtg ttcgtgctggctttctcattgatcagcagggctagctatgaaaatgttcttaagaagtgg atgccagagcttcgtcgatttgcgccgaatgttccagttattcttgttgggaccaagttg gatctccgtgaccacagagcatacctggctgaccatcctggtgcttcaacaatcacgacg gcagagggtgaagaactgagaaagcagattggtgctgcagcttatatagagtgcagttcc aaaacgcagcagaatgtcaaggttgtctttgataccgccatcaaagtggtccttcaaccc cctcgcagaagggaggcgatgactcccaggaagaaaagtaagaaaagctccggacgctct ataatgagcctgatgtgtggcagcacttgtgttgcctag

DBGET integrated database retrieval system