Phragmites australis (common reed): 133891746 Help Entry 133891746         CDS       T10575                                  Name (RefSeq) rac-like GTP-binding protein 7   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism paua  Phragmites australis (common reed) Pathway paua04145   Phagosome paua04148   Efferocytosis paua04517   IgSF CAM signaling paua04518   Integrin signaling paua04620   Toll-like receptor signaling pathway paua05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:paua00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     133891746    04518 Integrin signaling     133891746  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     133891746    04148 Efferocytosis     133891746  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     133891746  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     133891746  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:paua04131]     133891746   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:paua04147]     133891746    04031 GTP-binding proteins [BR:paua04031]     133891746 Membrane trafficking [BR:paua04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     133891746  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     133891746   Macropinocytosis    Ras GTPases     133891746  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     133891746 Exosome [BR:paua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    133891746   Exosomal proteins of other body fluids (saliva and urine)    133891746   Exosomal proteins of colorectal cancer cells    133891746   Exosomal proteins of bladder cancer cells    133891746 GTP-binding proteins [BR:paua04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     133891746 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  133891746 NCBI-ProteinID:  XP_062188470 LinkDB All DBs Position 14:complement(18831716..18834282) Genome browser AA seq 197 aa AA seqDB search MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWIPELRHYAPNVPIVLVGTKL DLLEDKQFFLDHPGLAPISTAQGEELKRMIGAAAYIECSSKTQQNVKAVFDSAIKVVLCP PKPKKKSARKQRSCWIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcacggcgaggttcatcaagtgcgtgacggtcggcgacggcgccgtcggcaagact tgcatgctcatttcctacaccagcaacaccttccccacggattacgtgcccacggtgttc gacaacttcagcgccaacgtcgtcgtcgacggcagcacggtgaacctcggcctctgggat accgctggacaagaggactacaaccggctgaggccccttagctacagaggcgctgacgtc tttctgttagcattttctctcattagcaaagccagctatgagaatattcacaagaagtgg ataccagagctgaggcactatgctccaaatgtgccaattgtgttagttggaacaaagctt gacttgctcgaggacaagcagttcttcctggaccaccctggtttagcacctatctcaacc gcgcagggtgaggagctgaagaggatgataggcgcagcggcgtacatcgaatgcagctcc aagacgcaacagaatgtgaaggcggtgttcgactctgcgatcaaggtcgtgctgtgcccg ccgaagccgaagaagaagagcgcccggaagcagaggagttgctggattctatga

DBGET integrated database retrieval system