Phragmites australis (common reed): 133895801 Help Entry 133895801         CDS       T10575                                  Name (RefSeq) sm-like protein LSM2   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism paua  Phragmites australis (common reed) Pathway paua03018   RNA degradation paua03040   Spliceosome Brite KEGG Orthology (KO) [BR:paua00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     133895801   09123 Folding, sorting and degradation    03018 RNA degradation     133895801  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:paua03019]     133895801    03041 Spliceosome [BR:paua03041]     133895801 Messenger RNA biogenesis [BR:paua03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      133895801   mRNA degradation factors    5'-3' decay     Lsm complex      133895801 Spliceosome [BR:paua03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     133895801  Complex C   U2 snRNP components     133895801 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM SM-ATX LSM14 DUF1256 DUF150_C Motif Other DBs NCBI-GeneID:  133895801 NCBI-ProteinID:  XP_062192301 LinkDB All DBs Position 16:3263197..3267299 Genome browser AA seq 93 aa AA seqDB search MLFFSYFKELVGKEVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNC FIRGSVVRYVLLPQDGVDTDILHDATRREARGG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttgttcttctcctacttcaaggagctcgtggggaaggaggtgacggtggagcttaag aacgatctggcgatccgcgggacactccactcggttgaccagtacctcaatatcaagctt gagaacactcgcgtcgtcgaccaggacaagtatccccacatgctatcggtgcgcaactgc ttcatcaggggttcagtggtgcggtacgtgctgctcccgcaggacggcgtcgacaccgac atcctccatgacgccaccaggagggaggcgcgcggaggctga

DBGET integrated database retrieval system