Phragmites australis (common reed): 133911045 Help Entry 133911045         CDS       T10575                                  Name (RefSeq) histone H2B.7-like   KO K11252   histone H2B Organism paua  Phragmites australis (common reed) Brite KEGG Orthology (KO) [BR:paua00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:paua03036]     133911045   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:paua04147]     133911045 Chromosome and associated proteins [BR:paua03036]  Eukaryotic type   Nucleosome assembly factors    Histones     133911045 Exosome [BR:paua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    133911045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  133911045 NCBI-ProteinID:  XP_062209254 LinkDB All DBs Position 3:19498082..19498333 Genome browser AA seq 83 aa AA seqDB search MAPKAEKKPAAKKPVEEELAAEKAQRGRSPRQRSGSTKLARYNKKPTITSHEIQTSVCLV LPGELAKHAVSMGTKGITKFTSS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggcgcccaaggcggagaagaagccggcggcaaagaagcctgtggaggaggagctcgct gcggagaaggcccagcggggaagaagcccaaggcagagaagcggctccaccaagctcgcc cgctacaacaagaagcccaccatcacctcccatgagatccagacctccgtctgcctcgtt ctcccaggggagctcgccaagcatgctgtctccatgggcaccaagggcatcaccaagttc acctcgtcttag

DBGET integrated database retrieval system