Phragmites australis (common reed): 133912383 Help Entry 133912383         CDS       T10575                                  Name (RefSeq) calmodulin-1   KO K02183   calmodulin Organism paua  Phragmites australis (common reed) Pathway paua04016   MAPK signaling pathway - plant paua04070   Phosphatidylinositol signaling system paua04075   Plant hormone signal transduction paua04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:paua00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     133912383    04070 Phosphatidylinositol signaling system     133912383    04075 Plant hormone signal transduction     133912383  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     133912383  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:paua01009]     133912383   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:paua04131]     133912383    03036 Chromosome and associated proteins [BR:paua03036]     133912383   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:paua04147]     133912383 Protein phosphatases and associated proteins [BR:paua01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      133912383 Membrane trafficking [BR:paua04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     133912383 Chromosome and associated proteins [BR:paua03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      133912383 Exosome [BR:paua04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    133912383 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin MotA_activ SPEF2_C FCaBP_EF-hand SurA_N_3 PA_Ig-like DUF6279 Fe_hyd_lg_C MecA_N Motif Other DBs NCBI-GeneID:  133912383 NCBI-ProteinID:  XP_062211063 LinkDB All DBs Position 3:15466117..15468200 Genome browser AA seq 149 aa AA seqDB search MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggaccagctcaccgacgaccagatcgccgagttcaaggaggccttcagcctcttc gacaaggacggcgacggttgcatcactaccaaggagctggggactgtcatgcgttctctg ggtcagaacccaaccgaggctgagctccaggacatgatcaacgaggtcgatgctgacggc aacggcaccatcgacttccccgagttcctcaacctcatggcccgcaagatgaaggacacc gactccgaggaagagctcaaggaggccttcagggtgttcgacaaggaccagaacggcttc atctccgctgccgagctccgccacgtcatgaccaaccttggcgagaagctaaccgacgag gaggtcgacgagatgatccgtgaggccgacgtcgacggcgacggccagatcaactacgag gagttcgtcaaggtgatgatggccaagtga

DBGET integrated database retrieval system