Phragmites australis (common reed): 133921264 Help Entry 133921264         CDS       T10575                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism paua  Phragmites australis (common reed) Pathway paua04145   Phagosome paua04148   Efferocytosis paua04517   IgSF CAM signaling paua04518   Integrin signaling paua04620   Toll-like receptor signaling pathway paua05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:paua00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     133921264    04518 Integrin signaling     133921264  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     133921264    04148 Efferocytosis     133921264  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     133921264  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     133921264  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:paua04131]     133921264   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:paua04147]     133921264    04031 GTP-binding proteins [BR:paua04031]     133921264 Membrane trafficking [BR:paua04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     133921264  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     133921264   Macropinocytosis    Ras GTPases     133921264  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     133921264 Exosome [BR:paua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    133921264   Exosomal proteins of other body fluids (saliva and urine)    133921264   Exosomal proteins of colorectal cancer cells    133921264   Exosomal proteins of bladder cancer cells    133921264 GTP-binding proteins [BR:paua04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     133921264 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  133921264 NCBI-ProteinID:  XP_062222049 LinkDB All DBs Position 6:5202163..5205528 Genome browser AA seq 214 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENIMKKWIPELQHYAPGVPIVLVGT KLDLREDKHYLLDHPGLTPVATAQGEELRRQIGAMYYVECSSKTQQNVKAVFDAAIKVVI QPPTKLREKKKKKSRRGCSIMNIFCGRKMLCFKS NT seq 645 nt NT seq  +upstreamnt  +downstreamnt atggcgtccagcgcctcccggttcatcaagtgcgtcacggtcggcgacggcgccgtgggc aagacctgcatgctcatctgctacaccagcaacaagttccccactgactacatacctacg gtgttcgacaatttcagcgcaaacgtagttgttgatggcaccacagtgaatttgggcctt tgggatactgcggggcaggaagattacaaccgactgaggcctctaagctaccgtggcgct gatgtcttcgtgcttgccttctcacttgtgagccgagctagctatgagaatatcatgaag aagtggataccggagcttcagcattatgcacctggggtgcccattgtattggttggcaca aaattggatcttcgtgaagacaagcactacttattggaccatcctgggttgacacctgtt gccacagcacagggcgaggaacttcgtagacaaattggtgctatgtattacgttgagtgc agctcaaagacacagcagaatgtcaaagctgtgtttgatgctgccatcaaagttgtaatc caacctccaactaaactcagagaaaagaagaaaaagaaatcacgacgaggatgttcaatt atgaacatcttctgtggaagaaaaatgctatgcttcaaatcctga

DBGET integrated database retrieval system