Phragmites australis (common reed): 133922809 Help Entry 133922809         CDS       T10575                                  Name (RefSeq) rac-like GTP-binding protein 6   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism paua  Phragmites australis (common reed) Pathway paua04145   Phagosome paua04148   Efferocytosis paua04517   IgSF CAM signaling paua04518   Integrin signaling paua04620   Toll-like receptor signaling pathway paua05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:paua00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     133922809    04518 Integrin signaling     133922809  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     133922809    04148 Efferocytosis     133922809  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     133922809  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     133922809  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:paua04131]     133922809   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:paua04147]     133922809    04031 GTP-binding proteins [BR:paua04031]     133922809 Membrane trafficking [BR:paua04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     133922809  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     133922809   Macropinocytosis    Ras GTPases     133922809  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     133922809 Exosome [BR:paua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    133922809   Exosomal proteins of other body fluids (saliva and urine)    133922809   Exosomal proteins of colorectal cancer cells    133922809   Exosomal proteins of bladder cancer cells    133922809 GTP-binding proteins [BR:paua04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     133922809 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  133922809 NCBI-ProteinID:  XP_062224284 LinkDB All DBs Position 6:44685231..44688871 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL DLRDDKQFFVDHPGAVPITTAQGEELRKQIGAPYYIECSSKTQLNVKGVFDAAIKVVLQP PKAKKKKKAQRGACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtccaggttcataaagtgcgtcacggtcggggacggcgccgttggcaagacc tgcatgctcatctcctacacctccaacaccttccccaccgattatgttccaacggtgttt gacaatttcagtgctaatgttgtggttgatggtaacactgtcaaccttgggctatgggac actgcaggtcaagaggattacaacagactgagaccactgagctatcgtggagctgatgtt ttccttctggccttctcgctaatcagtaaggcaagctacgagaatgtttctaagaagtgg atacctgagctgaagcattacgcacccggtgtgccaataattctcgtggggacaaagctc gatcttcgagatgacaagcagttctttgtggaccatcctggtgctgttcctatcactact gctcagggagaggagctaagaaagcaaataggcgctccatactacattgaatgcagctca aagacccaactaaacgtaaagggtgtcttcgatgctgcgataaaggtggtactgcagcca cccaaggcaaagaagaagaaaaaggcgcagaggggagcttgctccattttgtga

DBGET integrated database retrieval system