Phragmites australis (common reed): 133926577 Help Entry 133926577         CDS       T10575                                  Name (RefSeq) rac-like GTP-binding protein 4   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism paua  Phragmites australis (common reed) Pathway paua04145   Phagosome paua04148   Efferocytosis paua04517   IgSF CAM signaling paua04518   Integrin signaling paua04620   Toll-like receptor signaling pathway paua05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:paua00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     133926577    04518 Integrin signaling     133926577  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     133926577    04148 Efferocytosis     133926577  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     133926577  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     133926577  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:paua04131]     133926577   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:paua04147]     133926577    04031 GTP-binding proteins [BR:paua04031]     133926577 Membrane trafficking [BR:paua04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     133926577  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     133926577   Macropinocytosis    Ras GTPases     133926577  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     133926577 Exosome [BR:paua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    133926577   Exosomal proteins of other body fluids (saliva and urine)    133926577   Exosomal proteins of colorectal cancer cells    133926577   Exosomal proteins of bladder cancer cells    133926577 GTP-binding proteins [BR:paua04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     133926577 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  133926577 NCBI-ProteinID:  XP_062228567 LinkDB All DBs Position 8:9814217..9823015 Genome browser AA seq 215 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVMKKWLPELQHYAPGVPIVLAGT KLDLREDKHYLLDHPGMVPVTTPQGEELRKHIGATCYIECSSKTQQNVKAVFDAAIKVVI KPQTKQRERKKRKARRGCSIFCSRIMHIRRLGCFK NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggcgtccagcgcctcccggttcatcaagtgcgtcacggtgggggacggcgccgtgggg aagacctgcatgctcatctgctacaccagcaacaagttccccactgattacatacccacc gtgttcgataatttcagcgcaaacgtggtggtcgacggcaccacagtgaatttgggcctt tgggacactgcagggcaggaagattacaacagattgcggccactgagctatcgcggagcc gatgtgttcgtgctcgccttctcgctcgtcagccgagctagctacgagaacgttatgaag aagtggctaccggagcttcagcattacgctcccggtgtgcccatagtgttggctgggacc aaactggatcttcgtgaagacaagcactacttacttgaccatcctggcatggtacctgtt actacaccacagggggaggaacttcgcaagcacatcggcgcaacatgttacattgagtgc agctcaaaaactcaacagaatgtcaaagctgtctttgacgctgccattaaggtggtaatc aagcctcaaacaaagcagagggaaaggaagaaaaggaaagcacggcgaggatgttcaata ttttgcagccgtatcatgcacataaggagactagggtgcttcaagtga

DBGET integrated database retrieval system