Phragmites australis (common reed): 133929220 Help Entry 133929220         CDS       T10575                                  Name (RefSeq) rac-like GTP-binding protein 2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism paua  Phragmites australis (common reed) Pathway paua04145   Phagosome paua04148   Efferocytosis paua04517   IgSF CAM signaling paua04518   Integrin signaling paua04620   Toll-like receptor signaling pathway paua05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:paua00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     133929220    04518 Integrin signaling     133929220  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     133929220    04148 Efferocytosis     133929220  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     133929220  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     133929220  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:paua04131]     133929220   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:paua04147]     133929220    04031 GTP-binding proteins [BR:paua04031]     133929220 Membrane trafficking [BR:paua04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     133929220  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     133929220   Macropinocytosis    Ras GTPases     133929220  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     133929220 Exosome [BR:paua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    133929220   Exosomal proteins of other body fluids (saliva and urine)    133929220   Exosomal proteins of colorectal cancer cells    133929220   Exosomal proteins of bladder cancer cells    133929220 GTP-binding proteins [BR:paua04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     133929220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA AAA_7 Motif Other DBs NCBI-GeneID:  133929220 NCBI-ProteinID:  XP_062231879 LinkDB All DBs Position 9:32286993..32289646 Genome browser AA seq 212 aa AA seqDB search MSVTKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVSVNGNIVNLGLWD TAGQEDYSRLRPLSYRGADVFVLAFSLISRASYENVLKKWMPELRRFAPNVPVVLVGTKL DLRDHRAYLAVHPGASTITTAQGEELRKQIGAAAYIECSSKTQQNVKSVFDTAIKVVLQP PRRREVMTAKKKSRRSSGCSIMNLMCGSTCVA NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atgagcgtgaccaagttcataaagtgcgtgacggtgggggacggcgcggtgggcaagacc tgcatgctcatctgctacaccagcaacaagttccccactgattacatccccacggtgttc gacaatttcagtgccaatgtctccgtgaatgggaacattgtcaacttgggtctatgggac actgctgggcaagaggattacagcaggttgaggccactgagttacaggggtgcagatgta tttgtgctggctttctccttgatcagcagggctagctatgagaatgttcttaagaagtgg atgccagagcttcgtcgatttgcaccgaatgttccagttgttcttgttgggaccaagtta gatctccgtgaccacagagcctaccttgccgttcatccaggtgcttcaacaatcacaaca gcacagggagaagaactgaggaagcagattggtgctgcagcttatattgaatgcagttcc aaaacgcagcagaatgtcaagtctgtcttcgataccgccatcaaagtggtccttcaaccc cctcgcagaagggaggtgatgactgccaagaagaaaagtaggcgaagctccggatgctct ataatgaacctgatgtgtggcagtacgtgtgttgcctag

DBGET integrated database retrieval system