Paenibacillus sp. URB8-2: PUR_00460 Help Entry PUR_00460         CDS       T10751                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism paub  Paenibacillus sp. URB8-2 Brite KEGG Orthology (KO) [BR:paub00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:paub03032]     PUR_00460    03036 Chromosome and associated proteins [BR:paub03036]     PUR_00460    03400 DNA repair and recombination proteins [BR:paub03400]     PUR_00460 DNA replication proteins [BR:paub03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     PUR_00460 Chromosome and associated proteins [BR:paub03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     PUR_00460 DNA repair and recombination proteins [BR:paub03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       PUR_00460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  BCG56621 UniProt:  A0A810DT42 LinkDB All DBs Position 50823..51095 Genome browser AA seq 90 aa AA seqDB search MNKTDLINNISEKNGLAKKDVELVLSGLLGEITEALASGDKVQLIGFGTFETRKRSGRTG RNPQTGTTIDIPESTVPAFKAGNKLKEAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaacagatctgatcaacaacatctccgagaaaaacggattggccaaaaaggac gtggagcttgtgctgagcggactccttggcgaaattaccgaggctctggcgagtggtgac aaagtacagctgatcggcttcggcacttttgaaacgcgcaagcgctccggacgtaccggc cgcaatccgcaaacgggcacaacgattgatattcctgaatcgacagttccggcgttcaag gccggcaacaagcttaaagaagccgtcaattaa

DBGET integrated database retrieval system