Paenibacillus sp. URB8-2: PUR_10890 Help Entry PUR_10890         CDS       T10751                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism paub  Paenibacillus sp. URB8-2 Pathway paub03060   Protein export paub03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:paub00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     PUR_10890  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     PUR_10890  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:paub02044]     PUR_10890 Secretion system [BR:paub02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    PUR_10890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  BCG57664 UniProt:  A0A810DT17 LinkDB All DBs Position 1213239..1213472 Genome browser AA seq 77 aa AA seqDB search MLNGIGAPGIILLVILALLLFGPNKLPELGRAVGRTFREFKEGTRDMIADSEPEVKSEAP APAAQKAPVSLEKRLPE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgttaaacggtattggggctccgggtattatactgcttgtcattctggcgctgctgctc tttggtccgaacaagctgcccgaattgggccgtgcagttggaagaaccttccgtgagttc aaggaagggacccgcgatatgattgccgactccgagccggaggtcaagagcgaagctcct gcaccggcggcgcagaaggcacccgtttccctggagaagcgtttgcccgaataa

DBGET integrated database retrieval system