Parerythrobacter aurantius: WAB17_05105 Help Entry WAB17_05105       CDS       T11164                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism paui  Parerythrobacter aurantius Pathway paui01100   Metabolic pathways paui01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paui00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WAB17_05105    00074 Mycolic acid biosynthesis     WAB17_05105   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WAB17_05105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 SerK_C Motif Other DBs NCBI-ProteinID:  WXK60701 LinkDB All DBs Position 1036084..1036329 Genome browser AA seq 81 aa AA seqDB search MDRAAVDSQIREIIEPFNKKGIEITDASTFQNDLEFDSLTVMDFVAEIEDAFDIIISMNQ QAEIENYGQLVDAVTKMAGDA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggaccgcgccgcagtcgacagccagatccgcgagatcatcgaacccttcaacaagaaa gggatcgagatcaccgatgccagcaccttccagaacgatctcgaattcgacagcctgacg gtgatggatttcgtcgccgagatcgaggacgccttcgacatcatcatcagcatgaaccag caggccgagatcgagaattacggccagcttgtggacgccgtcacgaaaatggcgggcgac gcctga

DBGET integrated database retrieval system