Paenibacillus aurantius: MJA45_00270 Help Entry MJA45_00270       CDS       T09594                                  Symbol atpE Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism paun  Paenibacillus aurantius Pathway paun00190   Oxidative phosphorylation paun01100   Metabolic pathways Module paun_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:paun00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     MJA45_00270 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:paun00194]     MJA45_00270 (atpE) Photosynthesis proteins [BR:paun00194]  Photosystem and electron transport system   F-type ATPase [OT]    MJA45_00270 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  WNQ11550 UniProt:  A0AA96LDW7 LinkDB All DBs Position 52630..52854 Genome browser AA seq 74 aa AA seqDB search MGALALVAAAIVFGLGALGAGIGNGLIVGRTVEGISRQPELRGTLQTTMFIGVALVEALP VITLVLAFIFYGQA NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgggagctttagcattagtagcagcagcaatcgtgtttggtctgggtgccttgggcgcc ggtatcggtaacggtttgatcgtaggacgtacggtagagggaatttcccgtcagcctgag cttcgcggaacgcttcaaacgacgatgtttatcggggttgcgctggtcgaggccctgccg gttatcaccctcgtattggctttcattttctacggccaagcttaa

DBGET integrated database retrieval system