Paenibacillus aurantius: MJA45_12425 Help Entry MJA45_12425       CDS       T09594                                  Symbol dut Name (GenBank) dUTP diphosphatase   KO K01520   dUTP diphosphatase [EC:3.6.1.23] Organism paun  Paenibacillus aurantius Pathway paun00240   Pyrimidine metabolism paun01100   Metabolic pathways paun01232   Nucleotide metabolism Module paun_M00938   Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP Brite KEGG Orthology (KO) [BR:paun00001]  09100 Metabolism   09104 Nucleotide metabolism    00240 Pyrimidine metabolism     MJA45_12425 (dut)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:paun03400]     MJA45_12425 (dut) Enzymes [BR:paun01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.23  dUTP diphosphatase      MJA45_12425 (dut) DNA repair and recombination proteins [BR:paun03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     MJA45_12425 (dut)  Prokaryotic type     MJA45_12425 (dut) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  dUTPase DCD Motif Other DBs NCBI-ProteinID:  WNQ14232 UniProt:  A0AA96RHN8 LinkDB All DBs Position 2740565..2740951 Genome browser AA seq 128 aa AA seqDB search MSELASGFDLHAAVGEPVILSPGERALVPTGFCLSMPGELEAQIRPRSGTAYKNGITALN SPGTIDADYRGEVKVLLINHGSESFRIKRGDRMAQMVFQYVPDIRLEEVEDLTETARGAG GFGHTGRS NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtccgagctcgctagcggctttgatcttcatgccgccgtcggcgaaccggtcattctg tcaccgggagagagagctttagttccaaccgggttctgcctgagcatgccgggagaactg gaagcgcaaattcgaccgcgttcgggaacggcctataagaatggaataaccgcccttaat tctccgggaacgattgatgccgattaccggggtgaggtgaaggtgcttctcatcaatcac ggcagcgaatcgttccgcatcaagcggggagaccggatggcccagatggtcttccaatac gtcccggacatccggctggaggaagtcgaggatctgacggaaacagcccgcggcgccgga ggcttcggccataccgggcgctcctga

DBGET integrated database retrieval system