Paenibacillus aurantius: MJA45_16825 Help Entry MJA45_16825       CDS       T09594                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism paun  Paenibacillus aurantius Brite KEGG Orthology (KO) [BR:paun00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:paun03032]     MJA45_16825    03036 Chromosome and associated proteins [BR:paun03036]     MJA45_16825    03400 DNA repair and recombination proteins [BR:paun03400]     MJA45_16825 DNA replication proteins [BR:paun03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     MJA45_16825 Chromosome and associated proteins [BR:paun03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     MJA45_16825 DNA repair and recombination proteins [BR:paun03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       MJA45_16825 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 DUF2267 Peptidase_C80 HU-CCDC81_euk_1 HU-DNA_bdg Glycos_trans_3N Motif Other DBs NCBI-ProteinID:  WNQ09292 UniProt:  A0AA96L943 LinkDB All DBs Position complement(3745248..3745520) Genome browser AA seq 90 aa AA seqDB search MNKSELITKVAESSELSKKDATKAVEAVFDAISEALQSGDKVQLVGFGNFEVRERSARKG RNPQTGEEIEIAASKVPSFKPGKALRDGIQ NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaatccgaattgattaccaaggtagctgaatcctccgagctttccaagaaggac gccaccaaagcggtagaagccgtgttcgatgccatttccgaagccctgcaaagcggagat aaggttcaacttgttggatttggaaatttcgaggttcgtgaacgttccgcccgtaaagga cgcaatcctcagacgggagaagaaatcgaaatcgccgccagcaaagtgccttctttcaag ccaggtaaagctctgagagacggaatccaatag

DBGET integrated database retrieval system