Pistricoccus aurantiacus: FGL86_14415 Help Entry FGL86_14415       CDS       T06130                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism paur  Pistricoccus aurantiacus Pathway paur01100   Metabolic pathways paur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paur00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FGL86_14415 (acpP)    00074 Mycolic acid biosynthesis     FGL86_14415 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FGL86_14415 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  QEA40153 UniProt:  A0A5B8SZC2 LinkDB All DBs Position complement(3052729..3052962) Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNVKEEDIQNTSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAIDYVNSHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtgaagaaggttgtggccgagcggctgaacgtcaaggaa gaggacattcagaacacctcttccttcactgaagatctcggcgccgattctctggatacc gtcgagttggtgatggcgctcgaagaggaattcgataccgaaattcccgacgaagaggcc gagaagatcaccaccgttcaggaagccatcgattacgtcaactctcatcagtaa

DBGET integrated database retrieval system