KEGG   Polyangium aurulentum: E8A73_015205
Entry
E8A73_015205      CDS       T08107                                 
Name
(GenBank) LD-carboxypeptidase
  KO
K01297  muramoyltetrapeptide carboxypeptidase [EC:3.4.17.13]
Organism
pauu  Polyangium aurulentum
Brite
KEGG Orthology (KO) [BR:pauu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pauu01002]
    E8A73_015205
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pauu01011]
    E8A73_015205
Enzymes [BR:pauu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.13  muramoyltetrapeptide carboxypeptidase
     E8A73_015205
Peptidases and inhibitors [BR:pauu01002]
 Serine peptidases
  Family S66
   E8A73_015205
Peptidoglycan biosynthesis and degradation proteins [BR:pauu01011]
 Precursor biosynthesis
  Carboxypeptidase
   E8A73_015205
SSDB
Motif
Pfam: Peptidase_S66C Peptidase_S66 Imm17
Other DBs
NCBI-ProteinID: UQA61737
LinkDB
Position
complement(3813853..3814722)
AA seq 289 aa
MLRPNATIAVVAPAGIPKLDGVAAGVELVRSWGYDVVLAPHLGDRHFYNAGTAGTRTADL
TWALTTPGIDAVWLARGGYGCVHCLAALPCEGLDGRPVLGCSDATSLFSALWKSRGGHLV
HGPMLETIATGVDDATRDRMRALLAGEAVEVIEGERLCGPNVEVSGPVIGGNLCVLASIA
GTPWAMSARGAIVVLEDIGEAAYRLDRMVTQLRWSGALDGALGIALGDFFQCKTPEGATY
TVEDVLQHVLAPLGVPVVGRMKIGHDKRNLAWRYGARGTLRADGLVQEG
NT seq 870 nt   +upstreamnt  +downstreamnt
gtgttgagaccgaacgcgaccatcgcggtggttgccccggcgggcatccccaagctcgac
ggcgtggcggcaggcgtagagctcgtccggagctggggatacgacgtggtgctggccccg
cacctcggcgatcgtcacttctacaacgcggggacggccgggacgcgcaccgcagatctc
acgtgggcgctcacgacgcctggcatcgacgcggtgtggctcgcgcgcggaggttacggc
tgcgtgcattgcctggcggccttgccgtgcgagggcctcgacggccgcccggtgctcggg
tgctcggatgcgacgtcgctcttctcggcgctgtggaagagccgcggcggccacctcgtg
cacgggccgatgctcgagacgatcgcgacgggcgtggacgacgcgacgcgggatcgcatg
cgcgcgctgctcgcgggagaggccgtcgaggtcatcgagggcgagcgtctgtgcgggccg
aacgtcgaggtgagcggccctgtgatcggcgggaacctgtgcgtgctggcgagcattgcg
ggcacgccctgggcgatgtcggcgcgcggggcgatcgtggtgctcgaggacatcggcgag
gcggcgtatcggctcgatcgaatggtgacgcagctgcgatggagcggcgcgctcgacggc
gcgctggggatcgcgctcggcgatttcttccagtgcaagacgccggagggggccacgtac
acggtcgaggacgtgctccagcacgtgctcgcgccgctcggggtgccggtggtgggacga
atgaagataggccacgacaaacggaacctggcgtggcgatacggggcgcgcgggaccttg
cgcgcggatgggctcgtgcaggagggctga

DBGET integrated database retrieval system