Polyangium aurulentum: E8A73_028875 Help Entry E8A73_028875      CDS       T08107                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism pauu  Polyangium aurulentum Pathway pauu00998   Biosynthesis of various antibiotics pauu01100   Metabolic pathways pauu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pauu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E8A73_028875    00074 Mycolic acid biosynthesis     E8A73_028875   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E8A73_028875 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  UQA55351 LinkDB All DBs Position 7245122..7245388 Genome browser AA seq 88 aa AA seqDB search MDPVDVRDRLKELMVSELNLEGKKPSDIDDAAPLFGEGLGLDSLDALQLAMSVEEKFGVR VPEGDEARSIFASVNALVDHIVRAKAAA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggatccggtggacgtgcgggacaggctcaaggaactcatggtgtccgagctcaacctc gaggggaagaaaccctcggacatcgacgatgcggcgccgctgtttggcgaggggctcggg ctcgactcgctcgatgcgttgcagctcgcgatgtccgtcgaggagaagttcggcgtgcgg gttcccgagggggacgaggcgcgcagcatcttcgcctccgtcaacgctctcgtggatcac atcgtgcgggcgaaggccgcggcctga

DBGET integrated database retrieval system