Prunus avium (sweet cherry): 110745478 Help Entry 110745478         CDS       T05161                                  Name (RefSeq) ras-related protein Rab7-like   KO K07897   Ras-related protein Rab-7A Organism pavi  Prunus avium (sweet cherry) Pathway pavi04142   Lysosome biogenesis pavi04144   Endocytosis pavi04145   Phagosome pavi04148   Efferocytosis Brite KEGG Orthology (KO) [BR:pavi00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     110745478    04145 Phagosome     110745478    04142 Lysosome biogenesis     110745478    04148 Efferocytosis     110745478  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pavi04131]     110745478   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pavi04147]     110745478    04031 GTP-binding proteins [BR:pavi04031]     110745478 Membrane trafficking [BR:pavi04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     110745478 Exosome [BR:pavi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110745478   Exosomal proteins of other body fluids (saliva and urine)    110745478   Exosomal proteins of colorectal cancer cells    110745478   Exosomal proteins of bladder cancer cells    110745478 GTP-binding proteins [BR:pavi04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     110745478 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Lyx_isomer Motif Other DBs NCBI-GeneID:  110745478 NCBI-ProteinID:  XP_021801260 UniProt:  A0A6P5R8R2 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search FHSLGASFYRGADCCVLVYDVNVSKSFETLQNWHEEFLKQADLTDPEAFPFVLLGNKIDV DGGNSRAVSEKKAREWCASKGNIPYFETSAKEDYNVDEAFLCIAKTGMINEHEQEIYFQG ISETVSEAEQRRSCAC NT seq 412 nt NT seq  +upstreamnt  +downstreamnt atttcatagtcttggagcttcgttttataggggagctgattgctgtgttcttgtgtatga tgtgaatgtgagcaaatcatttgaaacacttcagaactggcatgaagagtttctcaaaca ggctgatctgactgaccccgaggcatttcccttcgtattacttggaaacaaaatcgatgt agatggtggaaacagccgtgcggtttctgagaagaaggctagagagtggtgtgcttcaaa gggaaacataccctactttgagacatctgcgaaagaggattataatgtcgacgaagcgtt tctatgcattgcgaaaacaggaatgatcaatgaacatgaacaagagatttacttccaagg tatttcagaaactgtttcagaagcagagcaaagaagaagctgtgcatgctaa

DBGET integrated database retrieval system