Prunus avium (sweet cherry): 110752698 Help Entry 110752698         CDS       T05161                                  Name (RefSeq) SKP1-like protein 11   KO K03094   S-phase kinase-associated protein 1 Organism pavi  Prunus avium (sweet cherry) Pathway pavi03083   Polycomb repressive complex pavi04120   Ubiquitin mediated proteolysis pavi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pavi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110752698    04120 Ubiquitin mediated proteolysis     110752698   09126 Chromosome    03083 Polycomb repressive complex     110752698  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pavi04131]     110752698    04121 Ubiquitin system [BR:pavi04121]     110752698    03036 Chromosome and associated proteins [BR:pavi03036]     110752698 Membrane trafficking [BR:pavi04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     110752698 Ubiquitin system [BR:pavi04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      110752698    Cul7 complex      110752698 Chromosome and associated proteins [BR:pavi03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      110752698   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      110752698 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ BTB Ribosomal_L1 Motif Other DBs NCBI-GeneID:  110752698 NCBI-ProteinID:  XP_021809103 UniProt:  A0A6P5S5N5 LinkDB All DBs Position Unknown AA seq 155 aa AA seqDB search MASDEMKKITLKSDDNQTFEVEVAVAMQSQTMKHMVEDDCVDDVIPLPNVTSSTLAKVIE YCKKHHEEDADVKNEETLKSWDTEFVKVDLHELFDLILAANYLDIKSLLYLTCQTVADMI KDKTPEEIRVIFNIENDFTPEEEKKIRKENEWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggcctctgacgaaatgaagaagataaccctaaagagcgacgacaaccagaccttcgag gtggaggtggctgtggccatgcaatcgcagaccatgaagcacatggtggaggacgactgt gtcgatgacgtgatacctctgccaaatgtgaccagcagcaccctagcgaaggtgatcgag tactgcaagaagcaccatgaagaggatgctgatgtcaagaacgaagagactctcaagagc tgggacactgagttcgtgaaggtggacctgcacgagctgtttgacctaatcttggctgca aactatctggacatcaagagcctattgtatttgacttgccagactgtggcggacatgatc aaggacaagacacctgaagagatccgtgtgatcttcaacatcgagaatgattttacgccc gaagaagaaaagaagattcgtaaggagaatgagtgggcattcgagtga

DBGET integrated database retrieval system