Prunus avium (sweet cherry): 110752715 Help Entry 110752715         CDS       T05161                                  Name (RefSeq) SKP1-like protein 11   KO K03094   S-phase kinase-associated protein 1 Organism pavi  Prunus avium (sweet cherry) Pathway pavi03083   Polycomb repressive complex pavi04120   Ubiquitin mediated proteolysis pavi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pavi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110752715    04120 Ubiquitin mediated proteolysis     110752715   09126 Chromosome    03083 Polycomb repressive complex     110752715  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pavi04131]     110752715    04121 Ubiquitin system [BR:pavi04121]     110752715    03036 Chromosome and associated proteins [BR:pavi03036]     110752715 Membrane trafficking [BR:pavi04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     110752715 Ubiquitin system [BR:pavi04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      110752715    Cul7 complex      110752715 Chromosome and associated proteins [BR:pavi03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      110752715   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      110752715 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  110752715 NCBI-ProteinID:  XP_021809126 UniProt:  A0A6P5S6D0 LinkDB All DBs Position Unknown AA seq 156 aa AA seqDB search MASVEMKKITLKSDDGEIFEVEEAVAMQSQTIRHMVEDDCADGAIPLQNVTSNILAKVIE YCKKHHEEDADGEKNKEDIENWDAGFVKVDQCTLFDLILVANYLNIKSLLDLTCQTVADM IKVKTPEEIRETFNIKNDFTPEEEEAIRKENQWAFE NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atggcctccgttgagatgaagaagataaccctgaagagcgacgacggtgagatctttgag gtggaggaggctgtggccatgcagtcgcagaccatcaggcacatggtggaggacgactgc gccgacggcgcaatacctctgcagaacgtgaccagcaacatcctagcgaaggtgatcgag tactgcaagaagcaccatgaagaggatgctgatggcgagaagaacaaagaggacattgag aactgggatgctgggttcgtgaaggtggaccagtgtaccctgtttgacttaatcttggtt gcaaactatctcaacatcaagagcttgctggatttgacctgccagactgtggcagacatg attaaggtaaagacacctgaagagatccgtgagaccttcaacatcaagaatgacttcaca cctgaggaagaagaggcgattcgtaaggagaaccagtgggcattcgagtga

DBGET integrated database retrieval system