Prunus avium (sweet cherry): 110753757 Help Entry 110753757         CDS       T05161                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pavi  Prunus avium (sweet cherry) Pathway pavi04145   Phagosome pavi04148   Efferocytosis pavi04620   Toll-like receptor signaling pathway pavi05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pavi00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     110753757    04148 Efferocytosis     110753757  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110753757  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     110753757  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pavi04131]     110753757   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pavi04147]     110753757    04031 GTP-binding proteins [BR:pavi04031]     110753757 Membrane trafficking [BR:pavi04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     110753757  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     110753757   Macropinocytosis    Ras GTPases     110753757  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     110753757 Exosome [BR:pavi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110753757   Exosomal proteins of other body fluids (saliva and urine)    110753757   Exosomal proteins of colorectal cancer cells    110753757   Exosomal proteins of bladder cancer cells    110753757 GTP-binding proteins [BR:pavi04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     110753757 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  110753757 NCBI-ProteinID:  XP_021810406 UniProt:  A0A6P5SA50 LinkDB All DBs Position Unknown AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIAKKWVPELRHYAPGVPIILVGTKL DLRDDKQFFVDHPGAVPITTAQGEELKKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKKRKAQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcctccaggttcataaagtgtgtcacagttggggacggagcggtgggcaagact tgcatgctcatctcctacaccagcaacactttccctacggattatgtgccaactgtgttt gacaatttcagtgcaaatgtggttgtggacgggagcactgttaatttgggattgtgggat actgctggacaggaagattacaatagattaagaccactgagctaccgtggggcagatgtc ttcctacttgcattctctctcataagtaaggccagctatgaaaatattgccaagaaatgg gttcctgaattgaggcattatgcacctggtgttccaattattcttgttggaactaagctt gatcttcgggatgataagcaattctttgtagatcaccctggtgcagtgccaattaccaca gcccagggagaggaactaaagaagctgattggggctccggtttacatcgaatgtagttca aaaacacagcagaatgtgaaagcagtctttgacgcagccattaaagtggttctccagcca ccaaaacagaagaagaaaaagaagagaaaggcacagaaggcctgttctatattgtga

DBGET integrated database retrieval system