Prunus avium (sweet cherry): 110758167 Help Entry 110758167         CDS       T05161                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism pavi  Prunus avium (sweet cherry) Pathway pavi03083   Polycomb repressive complex pavi04120   Ubiquitin mediated proteolysis pavi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pavi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110758167    04120 Ubiquitin mediated proteolysis     110758167   09126 Chromosome    03083 Polycomb repressive complex     110758167  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pavi04131]     110758167    04121 Ubiquitin system [BR:pavi04121]     110758167    03036 Chromosome and associated proteins [BR:pavi03036]     110758167 Membrane trafficking [BR:pavi04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     110758167 Ubiquitin system [BR:pavi04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      110758167    Cul7 complex      110758167 Chromosome and associated proteins [BR:pavi03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      110758167   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      110758167 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Skp1 Methyltransf_16 BTB Motif Other DBs NCBI-GeneID:  110758167 NCBI-ProteinID:  XP_021815668 UniProt:  A0A6P5SPM9 LinkDB All DBs Position Unknown AA seq 156 aa AA seqDB search MSSSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEY CKKHVDAAKPDEKISEDDLKAWDTDFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcgtcgtcaaagaagatcaccctgaagagctctgatggcgaatcgttcgaggtt gaagaggcggtggctctcgagtcgcagaccatcaagcatatgatcgaggacgattgcgcc gacaacggcattcctctgcccaacgtgacgagcaagatcttggccaaggtcatcgagtac tgcaagaagcacgtcgacgctgccaagcctgatgagaagatctccgaggatgatctcaag gcttgggatacggactttgtcaaagttgaccaggcaaccctatttgatctcattctggct gcaaactacttgaacatcaagagcctgctggacctgacatgccagactgttgcggacatg atcaaggggaagaccccagaggagatccgaaagaccttcaatatcaagaacgacttcacc ccggaggaggaggaggaagttcgtcgcgagaaccagtgggcatttgaatga

DBGET integrated database retrieval system