Prunus avium (sweet cherry): 110766890 Help Entry 110766890         CDS       T05161                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pavi  Prunus avium (sweet cherry) Pathway pavi04145   Phagosome pavi04148   Efferocytosis pavi04517   IgSF CAM signaling pavi04518   Integrin signaling pavi04620   Toll-like receptor signaling pathway pavi05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pavi00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     110766890    04518 Integrin signaling     110766890  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     110766890    04148 Efferocytosis     110766890  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110766890  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     110766890  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pavi04131]     110766890   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pavi04147]     110766890    04031 GTP-binding proteins [BR:pavi04031]     110766890 Membrane trafficking [BR:pavi04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     110766890  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     110766890   Macropinocytosis    Ras GTPases     110766890  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     110766890 Exosome [BR:pavi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110766890   Exosomal proteins of other body fluids (saliva and urine)    110766890   Exosomal proteins of colorectal cancer cells    110766890   Exosomal proteins of bladder cancer cells    110766890 GTP-binding proteins [BR:pavi04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     110766890 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  110766890 NCBI-ProteinID:  XP_021825986 UniProt:  A0A6P5TFP4 LinkDB All DBs Position Unknown AA seq 211 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLAGT KLDLREDKHYLADHPGLVPVTTAQGEELRKQIGASFYIECSSKTQQNVKAVFDAAIRVVI KPPQKQKEKKKKENRGCLVNILCGRRLVCLK NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggcgtcaagcgcttcaaggttcatcaagtgtgtgacggtgggagatggagctgtgggg aagacctgtatgcttatttgctacaccagcaacaaatttcccactgattatatacccact gtgtttgataacttcagcgctaatgtggtggttgaaggcaccacagtgaacttaggccta tgggacaccgcagggcaagaggattacaatcgattaaggccattgagctacagaggggca gatgtctttgtcttagctttctcattagttagtcgtgcaagctatgagaacgtgctgaaa aagtggatccctgaactccagcattatgctcccggagtcccagttgtacttgctggcacc aaattagatcttcgagaggataagcactatttggctgatcacccaggattggtacctgtg accactgcacagggcgaggagctgcgcaagcagattggtgcttcattttatatagaatgc agctcaaaaactcagcagaatgtgaaagcagtttttgatgctgcgatcagggtggttatc aagcctccacagaagcagaaggagaagaagaaaaaggaaaatcgaggatgcctagtcaac atcctttgcggaaggaggctagtgtgtctcaaatga

DBGET integrated database retrieval system