Prunus avium (sweet cherry): 110768077 Help Entry 110768077         CDS       T05161                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism pavi  Prunus avium (sweet cherry) Pathway pavi03083   Polycomb repressive complex pavi04120   Ubiquitin mediated proteolysis pavi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pavi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110768077    04120 Ubiquitin mediated proteolysis     110768077   09126 Chromosome    03083 Polycomb repressive complex     110768077  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pavi04131]     110768077    04121 Ubiquitin system [BR:pavi04121]     110768077    03036 Chromosome and associated proteins [BR:pavi03036]     110768077 Membrane trafficking [BR:pavi04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     110768077 Ubiquitin system [BR:pavi04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      110768077    Cul7 complex      110768077 Chromosome and associated proteins [BR:pavi03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      110768077   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      110768077 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  110768077 NCBI-ProteinID:  XP_021827458 UniProt:  I1ZBR1 LinkDB All DBs Position Unknown AA seq 156 aa AA seqDB search MSSERKITLKSSDGETFEVDEAVALESQTIKHMVEDDCADNGIPLPNVTSKILAKVIEYC KKHVDAAKPDDRPSNDEDLKAWDTDFVKIDQATLFDLILAANYLNIKSLLDLTCQTVADM IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcagagaggaagataacactgaaaagctcggacggcgagacgttcgaggtggac gaggcggtggccttggagtctcagacgataaagcacatggtcgaggacgattgtgcggac aatgggatcccacttcccaacgtcaccagcaagatcttggcaaaggtcatcgagtactgc aagaagcacgtcgacgctgctaagcccgacgaccgcccttccaacgatgaggacctcaag gcctgggacaccgactttgtcaagatcgaccaggccaccctcttcgatcttatactggct gcaaactatttgaacataaagagcttgctggacctgacttgccaaacagtggcggatatg atcaagggcaaaacacctgaggagattcgcaagacgttcaacattaagaacgactttacg cccgaggaagaggaggaggtccgcagggagaaccaatgggccttcgagtga

DBGET integrated database retrieval system