Pseudomonas avellanae: BKM03_26000 Help Entry BKM03_26000       CDS       T05369                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism pavl  Pseudomonas avellanae Pathway pavl02024   Quorum sensing pavl03018   RNA degradation Brite KEGG Orthology (KO) [BR:pavl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     BKM03_26000  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     BKM03_26000  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pavl03019]     BKM03_26000    03036 Chromosome and associated proteins [BR:pavl03036]     BKM03_26000 Messenger RNA biogenesis [BR:pavl03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      BKM03_26000 Chromosome and associated proteins [BR:pavl03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     BKM03_26000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AVB22266 UniProt:  A0A261WJ95 LinkDB All DBs Position complement(5411483..5411743) Genome browser AA seq 86 aa AA seqDB search MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAIS TVVPVRPIRLPSATDADGADAEPGNA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacttgaacaccttgcgaaaggagaaggtc ggcgtctcgatctacctggtcaacggtatcaagctgcagggaacgatcgagtctttcgac cagttcgtcattttgctgaaaaacactgtcagccagatggtctacaaacacgccatttcc accgtcgtaccggttcgcccgattcgcctgcctagcgctaccgacgctgacggcgctgac gccgagccaggtaacgcctga

DBGET integrated database retrieval system