Pseudomonas avellanae: BKM03_26800 Help Entry BKM03_26800       CDS       T05369                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pavl  Pseudomonas avellanae Pathway pavl00998   Biosynthesis of various antibiotics pavl01100   Metabolic pathways pavl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pavl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BKM03_26800    00074 Mycolic acid biosynthesis     BKM03_26800   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BKM03_26800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AVB22412 UniProt:  A0A261WFW9 LinkDB All DBs Position 5603087..5603341 Genome browser AA seq 84 aa AA seqDB search MQTREDIFEILRAAMVELFELEPERVTLDANLYQDLEIDSIDAVDLIDHIKRKTGKKIAA EEFKSVKTVDDVVEAVYRLVNAAE NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaaacccgtgaagacatcttcgaaatcctccgcgccgcgatggtggaactgttcgaa ctggagcctgaaagggtcacgctggacgccaacctgtatcaggacctggaaatcgacagc atcgatgccgtggacctgatcgaccacatcaaacgcaagaccggcaaaaagattgctgca gaagaattcaagtcggtcaaaaccgtcgacgacgtggtcgaggccgtctaccgcctggtc aacgcagccgaatga

DBGET integrated database retrieval system