Pseudomonas avellanae: BKM03_30470 Help Entry BKM03_30470       CDS       T05369                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pavl  Pseudomonas avellanae Brite KEGG Orthology (KO) [BR:pavl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pavl03032]     BKM03_30470    03036 Chromosome and associated proteins [BR:pavl03036]     BKM03_30470    03400 DNA repair and recombination proteins [BR:pavl03400]     BKM03_30470 DNA replication proteins [BR:pavl03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BKM03_30470 Chromosome and associated proteins [BR:pavl03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BKM03_30470 DNA repair and recombination proteins [BR:pavl03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BKM03_30470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG SSPI HU-CCDC81_euk_2 HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  AVB23387 UniProt:  A0AAD0M773 LinkDB All DBs Position p1_tig4:complement(96029..96334) Genome browser AA seq 101 aa AA seqDB search MALTKDQFIAVIAEAIDAPKNTTGKALEQLGQIVADQLGNGAEITLPGIGKLKVAERPAR TGRHPSTGAAIEIAAKKVIKFVPAKVLNDAINNGAPQKKGL NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggctctgactaaagaccaattcatcgccgttatcgcagaagctatcgacgcgccaaaa aacaccacgggtaaggctcttgagcaattgggacagatcgttgccgaccagctgggcaac ggtgcagaaatcactctaccgggcatcggcaaactgaaagtggcagagcgcccagcccgc actggccgccacccttcgactggcgccgccatcgaaatcgctgccaagaaagtcatcaag ttcgtcccggccaaggtgctgaacgacgcgatcaacaacggtgcgcctcagaaaaagggg ttgtaa

DBGET integrated database retrieval system