Pseudomonas avellanae: BKM03_31345 Help Entry BKM03_31345       CDS       T05369                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pavl  Pseudomonas avellanae Brite KEGG Orthology (KO) [BR:pavl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pavl03032]     BKM03_31345    03036 Chromosome and associated proteins [BR:pavl03036]     BKM03_31345    03400 DNA repair and recombination proteins [BR:pavl03400]     BKM03_31345 DNA replication proteins [BR:pavl03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BKM03_31345 Chromosome and associated proteins [BR:pavl03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BKM03_31345 DNA repair and recombination proteins [BR:pavl03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BKM03_31345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 SSPI Motif Other DBs NCBI-ProteinID:  AVB23514 UniProt:  A0AAD0GUH3 LinkDB All DBs Position p3_tig6:complement(30388..30681) Genome browser AA seq 97 aa AA seqDB search MALTKDQLVAGIAEAIDAPKNTARKVLEQLGQIVADQLESGAEITLPGIGKLKVAERPAR TGRNPSTGATIEIAAKKVVKFVSAKVLNDAINKGGVS NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggctctgacgaaagaccaattggttgccggtattgcagaagctatcgatgcgccaaaa aacaccgcgcgtaaggttcttgagcaattgggacagatcgttgccgaccaactggaaagc ggtgcagaaatcactctaccgggcatcggcaaattgaaagttgcagagcgtccagcacgc actggccgcaacccttcgactggtgccaccatcgaaatcgctgccaagaaagtcgtcaag ttcgtctcggctaaagtgctgaacgacgcgatcaacaagggcggcgtctcatag

DBGET integrated database retrieval system