Photorhabdus asymbiotica: PAU_00626 Help Entry PAU_00626         CDS       T00941                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism pay  Photorhabdus asymbiotica Pathway pay01100   Metabolic pathways pay01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pay00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PAU_00626   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PAU_00626 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Fer4_24 Motif Other DBs NCBI-ProteinID:  CAQ82718 UniProt:  C7BKN2 LinkDB All DBs Position complement(708739..708933) Genome browser AA seq 64 aa AA seqDB search MITVEEVCAQISMIVPDVTVNPDDKLDESGIDSMTLVRLVLQLENEFDIMIPDALLGPET FIPA NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgataactgtagaagaagtctgcgcgcaaatctcaatgattgttcctgatgttactgtt aatccagatgataaactggatgaaagtggaattgatagtatgacgttggtacgattagtt ttgcaacttgaaaatgagtttgacattatgattcctgatgcattattaggcccggaaaca tttatacccgcttaa

DBGET integrated database retrieval system