Photorhabdus asymbiotica: PAU_02400 Help Entry PAU_02400         CDS       T00941                                  Name (GenBank) conserved hypothetical protein   KO K02078   acyl carrier protein Organism pay  Photorhabdus asymbiotica Pathway pay01100   Metabolic pathways pay01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pay00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PAU_02400    00074 Mycolic acid biosynthesis     PAU_02400   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PAU_02400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L12_N PHA-1 MAD7 Motif Other DBs NCBI-ProteinID:  CAQ84492 UniProt:  B6VL77 LinkDB All DBs Position complement(2744406..2744648) Genome browser AA seq 80 aa AA seqDB search MENLENHVKSVVAEQLGIPEAQILTTQTFEELGADSLDNVELIMALEERFGITIDDSEAE EMVTIQNAIDCIRMKLESAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gtggaaaatttagagaatcatgttaaaagcgttgttgcagaacaacttggaatacccgaa gcccagattcttaccacacagacatttgaggaattgggagccgattcgttagacaatgtt gagctgatcatggctctggaagagcgtttcgggataactattgatgattcagaagcggaa gaaatggtgacgatacaaaacgccattgattgtattcgtatgaagctagaatctgctagc taa

DBGET integrated database retrieval system