Photorhabdus asymbiotica: PAU_04254 Help Entry PAU_04254         CDS       T00941                                  Symbol yiiU Name (GenBank) conserved hypothetical protein   KO K09892   cell division protein ZapB Organism pay  Photorhabdus asymbiotica Brite KEGG Orthology (KO) [BR:pay00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pay03036]     PAU_04254 (yiiU) Chromosome and associated proteins [BR:pay03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PAU_04254 (yiiU) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB TMF_TATA_bd Leu_zip PspA_IM30 Herpes_UL6 CtIP_N Rootletin Nuf2_DHR10-like ERM_helical UPF0242 XRCC4_CC YabA DUF3450 Occludin_ELL KASH_CCD APG6_N ADIP DUF677 Seryl_tRNA_N COG6_N HAUS-augmin3 DUF7801 DivIC Cnn_1N HAUS6_N DUF1005 Cep57_CLD_2 Shugoshin_N bZIP_1 dCache_2 DUF7491 GIT_CC DUF2968 HALZ Prominin DUF6262 Rx_N SlyX bZIP_2 Motif Other DBs NCBI-ProteinID:  CAQ86341 UniProt:  B6VLU2 LinkDB All DBs Position complement(4925105..4925413) Genome browser AA seq 102 aa AA seqDB search MLLDRGALATYNQTIAYKGEPRMSFEVFEKLEAKVQQAVDTITLLQMEIEELKEKNRSLS QEIQNATSSNESLAHENEQLRQEQQGWQERLRALLGKMEDVQ NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgttgctagacaggggcgctttggctacatacaatcagacgattgcttataagggggaa ccgagaatgtcatttgaagtttttgaaaagctggaagctaaggttcagcaggcggttgat actattaccctgctacaaatggaaattgaagaattaaaagaaaaaaacagatctttatct caggaaattcagaatgcaaccagcagcaatgagtctttggctcatgaaaatgagcaatta agacaagagcagcaggggtggcaagagcgccttcgtgctttgttaggcaaaatggaagat gtccagtaa

DBGET integrated database retrieval system