KEGG   Paenibacillus sp. YPG26: LDO05_12145
Entry
LDO05_12145       CDS       T11186                                 
Name
(GenBank) response regulator
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
payg  Paenibacillus sp. YPG26
Pathway
payg02020  Two-component system
payg02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:payg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LDO05_12145
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    LDO05_12145
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:payg02022]
    LDO05_12145
   02035 Bacterial motility proteins [BR:payg02035]
    LDO05_12145
Two-component system [BR:payg02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   LDO05_12145
Bacterial motility proteins [BR:payg02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    LDO05_12145
SSDB
Motif
Pfam: Response_reg B12-binding
Other DBs
NCBI-ProteinID: USB32086
LinkDB
Position
complement(2584247..2584612)
AA seq 121 aa
MANRILIVDDAAFMRMMIRDILTKNGFEVVGEAQDGAQAIEKYKELRPDLITMDITMPEM
DGIAALKEIKKLDAGAKVIMCSAMGQQAMVIDAIQAGAKDFIVKPFQSDRVVEAINKTLG
V
NT seq 366 nt   +upstreamnt  +downstreamnt
atggcaaatcgaattcttatcgtggacgatgctgcatttatgcgtatgatgatcagagac
attctgactaaaaatggttttgaagtagtaggggaagcacaagatggcgctcaagcgatc
gaaaaatataaagagcttcgcccggatcttattacaatggatattaccatgccagaaatg
gatggaattgctgcccttaaagaaatcaagaagctggacgccggggctaaagttattatg
tgttccgcaatgggtcagcaggcaatggttattgacgcaatccaagcgggtgcgaaggac
tttatcgttaagcctttccaatccgatcgtgttgtggaagccattaacaagacacttggt
gtgtag

DBGET integrated database retrieval system