Paenarthrobacter sp. YJN-5: HMI59_02500 Help Entry HMI59_02500       CDS       T10115                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism payj  Paenarthrobacter sp. YJN-5 Brite KEGG Orthology (KO) [BR:payj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:payj03032]     HMI59_02500    03036 Chromosome and associated proteins [BR:payj03036]     HMI59_02500    03400 DNA repair and recombination proteins [BR:payj03400]     HMI59_02500 DNA replication proteins [BR:payj03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     HMI59_02500 Chromosome and associated proteins [BR:payj03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     HMI59_02500 DNA repair and recombination proteins [BR:payj03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       HMI59_02500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  QOT15566 UniProt:  A0A7M2BZC7 LinkDB All DBs Position 528811..529098 Genome browser AA seq 95 aa AA seqDB search MAKNRSELVAEVAGKAGTSQAAVNSVLDALFEVFETSVAAGEKITIPGWLAVERTDRAAR TGRNPQTGETIQIAAGHSVKLTAGSKLKAAVAKKK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctaagaaccgtagtgaactcgttgcagaggtagcaggcaaggccggcaccagccag gcagccgtgaactccgtgctcgatgcactgttcgaagttttcgagacttctgttgctgca ggcgagaagatcaccatcccgggctggctcgcagttgagcgcaccgaccgcgcagcacgc accggccgtaacccgcagaccggcgagacgatccagatcgcagccggccacagcgtcaag ctgaccgcaggctccaagctgaaggctgctgtcgccaagaagaagtag

DBGET integrated database retrieval system